FGF 23 Human, His-Fibroblast Growth Factor

our services
our products
Quotations & Ordering:

For quotations, please use our online quotation form, and you may also contact us by

service@kendallscientific.com

Phone:

+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))

Fax:

+1-888.733.6849

Our customer service representatives are available 24 hours, Monday through Friday to assist you.

FGF 23 Human, His

Qty


Total
$65
Catalog #
CYPS-381
Size
Description
Fibroblast Growth Factor-23 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain expressed with a -6xHis tag containing a total of 257 amino acids (251 a.a. FGF23+ 6 a.a. His tag) and having a molecular mass of 28629.5 Dalton. The FGF-23 is and purified by chromatographic techniques.
Additional Information
Introduction FGF-23 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-23 inhibits renal tubular phosphate transport. This gene was identified by its mutations associated with autosomal dominant hypophosphatemic rickets (ADHR), an inherited phosphate wasting disorder. Abnormally high level expression of FGF23 was found in oncogenic hypophosphatemic osteomalacia (OHO), a phenotypically similar disease caused by abnormal phosphate metabolism. Mutations FGF23 have also been shown to cause familial tumoral calcinosis with hyperphosphatemia.
Synonyms Tumor-derived hypophosphatemia-inducing factor, HYPF, ADHR, HPDR2, PHPTC, FGF23, FGF-23, Fibroblast Growth Factor-23.
Source Escherichia Coli.
Physical Appearance Sterile Filtered white lyophilized powder.
Formulation The protein (0.5mg/ml) was lyophilized from 25mM Tris pH7.5 and 0.6M NaCl solution.
Solubility It is recommended to reconstitute the lyophilized Fibroblast Growth Factor-23 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability Lyophilized Fibroblast Growth Factor 23 althoµgh stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGF-23 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Amino Acid Sequence MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHH
Purity Greater than 90.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Biological Activity Treatment with hrFGF23 has been shown to induce FGFR mediated Erk phosphorylation, reduce plasma PTH levels in rats and to reduce blood phosphate levels (Ref 1).
Usage NeoBiolab's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals.
Background

N/A

Protocol

N/A

MSDS
Reviews
Kendall Scientific welcomes feedback from its customers.

If you have used an our product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information.

If you have any additional inquiries please email technical services at info@kendallscientific.com.

Thank you for your support.

promotions


Custom Monoclonal Antibody
MassAb Technologies
Image
Free Trial Custom Polyclonal Antibody
You will receive free purified antibodies for validation
Image
Custom Peptides Synthesis

Start from $40/each

new technologies

Image
Optimized for enhanced
expression levels
XPromoter 2.0
Image
E.coli/insect cells/293 & CHO

3 in 1 expression system
Image
MassAb Technologies

Cover All Epitopes